Lineage for d2lagb2 (2lag B:110-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762155Protein automated matches [190888] (2 species)
    not a true protein
  7. 2762158Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries)
  8. 2762238Domain d2lagb2: 2lag B:110-212 [242825]
    Other proteins in same PDB: d2laga_
    automated match to d2hyma2

Details for d2lagb2

PDB Entry: 2lag (more details)

PDB Description: Structure of the 44 kDa complex of interferon-alpha2 with the extracellular part of IFNAR2 obtained by 2D-double difference NOESY
PDB Compounds: (B:) Interferon alpha/beta receptor 2

SCOPe Domain Sequences for d2lagb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lagb2 b.1.2.1 (B:110-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pefeivgftnhinvmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnftyi
idklipntnycvsvylehsdeqaviksplkctllppgqesefs

SCOPe Domain Coordinates for d2lagb2:

Click to download the PDB-style file with coordinates for d2lagb2.
(The format of our PDB-style files is described here.)

Timeline for d2lagb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2lagb1
View in 3D
Domains from other chains:
(mouse over for more information)
d2laga_