PDB entry 2lag

View 2lag on RCSB PDB site
Description: Structure of the 44 kDa complex of interferon-alpha2 with the extracellular part of IFNAR2 obtained by 2D-double difference NOESY
Class: immune system
Keywords: interferon, receptor, IMMUNE SYSTEM
Deposited on 2011-03-13, released 2011-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2laga_
  • Chain 'B':
    Compound: Interferon alpha/beta receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNAR2, IFNABR, IFNARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2lagb1, d2lagb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lagA (A:)
    cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lagB (B:)
    sydspdytdesctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncan
    ttrsfcdltdewrstheayvtvlegfsgnttlfscshnfwlaidmsfeppefeivgftnh
    invmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnftyiidklipntnyc
    vsvylehsdeqaviksplkctllppgqesefs