| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
Superfamily d.6.1: Prion-like [54098] (1 family) ![]() |
| Family d.6.1.1: Prion-like [54099] (3 proteins) |
| Protein automated matches [191016] (6 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [234629] (12 PDB entries) |
| Domain d2l1ea_: 2l1e A: [242733] automated match to d1xyxa_ |
PDB Entry: 2l1e (more details)
SCOPe Domain Sequences for d2l1ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l1ea_ d.6.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsvvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnavhd
cvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss
Timeline for d2l1ea_: