Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein Myotrophin [48419] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [255385] (1 PDB entry) |
Domain d2kxpc_: 2kxp C: [242694] Other proteins in same PDB: d2kxpa_, d2kxpb_ automated match to d1myoa_ applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 2kxp (more details)
SCOPe Domain Sequences for d2kxpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kxpc_ d.211.1.1 (C:) Myotrophin {Mouse (Mus musculus) [TaxId: 10090]} mcdkefmwalkngdldevkdyvakgedvnrtleggrkplhyaadcgqleileflllkgad inapdkhhitpllsavyeghvscvklllskgadktvkgpdgltaleatdnqaikallq
Timeline for d2kxpc_: