SCOPe 2.07: Domain d2kxpc_: 2kxp C:

Lineage for d2kxpc_ (2kxp C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein Myotrophin [48419] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [255385] (1 PDB entry)

8. Domain d2kxpc_: 2kxp C: [242694]
   Other proteins in same PDB: d2kxpa_, d2kxpb_
   automated match to d1myoa_

Details for d2kxpc_

PDB Entry: 2kxp

PDB Description: Solution NMR structure of V-1 bound to capping protein (CP)

PDB Compounds: (C:) myotrophin

SCOPe Domain Sequences for d2kxpc_:

Sequence; same for both SEQRES and ATOM records:

>d2kxpc_ d.211.1.1 (C:) Myotrophin {Mouse (Mus musculus) [TaxId: 10090]}
mcdkefmwalkngdldevkdyvakgedvnrtleggrkplhyaadcgqleileflllkgad
inapdkhhitpllsavyeghvscvklllskgadktvkgpdgltaleatdnqaikallq

Timeline for d2kxpc_:

• d2kxpc_ first appeared in SCOPe 2.04
  
• d2kxpc_ appears in SCOPe 2.06
  
• d2kxpc_ appears in the current release, SCOPe 2.08