![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.43: Subunits of heterodimeric actin filament capping protein Capz [90095] (1 superfamily) 3 domains: (1) protozoan pheromone-like alpha-helical bundle; (2) rubredoxin-like domain lacking metal-binding site; (3) alpha+beta heterodimerisation domain: alpha-beta(5)-alpha |
![]() | Superfamily e.43.1: Subunits of heterodimeric actin filament capping protein Capz [90096] (3 families) ![]() |
![]() | Family e.43.1.1: Capz alpha-1 subunit [90097] (1 protein) automatically mapped to Pfam PF01267 |
![]() | Protein Capz alpha-1 subunit [90098] (1 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [90099] (12 PDB entries) |
![]() | Domain d2kxpa_: 2kxp A: [242692] Other proteins in same PDB: d2kxpb_, d2kxpc_ automated match to d1izna_ |
PDB Entry: 2kxp (more details)
SCOPe Domain Sequences for d2kxpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kxpa_ e.43.1.1 (A:) Capz alpha-1 subunit {Chicken (Gallus gallus) [TaxId: 9031]} rvsdeekvriaakfithappgefnevfndvrlllnndnllregaahafaqynmdqftpvk iegyddqvlitehgdlgngrfldprnkisfkfdhlrkeasdpqpedtesalkqwrdacds alrayvkdhypngfctvygksidgqqtiiacieshqfqpknfwngrwrsewkftitppta qvaavlkiqvhyyedgnvqlvshkdiqdsvqvssdvqtakefikiienaeneyqtaisen yqtmsdttfkalrrqlpvtrtkidwnkilsykigk
Timeline for d2kxpa_: