Lineage for d2ku4a_ (2ku4 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635622Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1635623Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1635624Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1635688Protein automated matches [191016] (6 species)
    not a true protein
  7. 1635691Species Horse (Equus caballus) [TaxId:9796] [255378] (1 PDB entry)
  8. 1635692Domain d2ku4a_: 2ku4 A: [242664]
    automated match to d1y2sa_

Details for d2ku4a_

PDB Entry: 2ku4 (more details)

PDB Description: horse prion protein
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2ku4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ku4a_ d.6.1.1 (A:) automated matches {Horse (Equus caballus) [TaxId: 9796]}
gsvvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvseysnqknfvhd
cvnitvkqhtvttttkgenftetdvkimervveqmcitqyqkeyeafqqrgas

SCOPe Domain Coordinates for d2ku4a_:

Click to download the PDB-style file with coordinates for d2ku4a_.
(The format of our PDB-style files is described here.)

Timeline for d2ku4a_: