SCOPe 2.04: Domain d2ku4a_: 2ku4 A:

Lineage for d2ku4a_ (2ku4 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (6 species)
   not a true protein

7. Species Horse (Equus caballus) [TaxId:9796] [255378] (1 PDB entry)

8. Domain d2ku4a_: 2ku4 A: [242664]
   automated match to d1y2sa_

Details for d2ku4a_

PDB Entry: 2ku4

PDB Description: horse prion protein

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2ku4a_:

Sequence; same for both SEQRES and ATOM records:

>d2ku4a_ d.6.1.1 (A:) automated matches {Horse (Equus caballus) [TaxId: 9796]}
gsvvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvseysnqknfvhd
cvnitvkqhtvttttkgenftetdvkimervveqmcitqyqkeyeafqqrgas

Timeline for d2ku4a_:

• d2ku4a_ is new in SCOPe 2.04-stable
  
• d2ku4a_ appears in SCOPe 2.05
  
• d2ku4a_ appears in the current release, SCOPe 2.08, called d2ku4a1