| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.299: Ns1 effector domain-like [143020] (1 superfamily) beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7] |
Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) ![]() automatically mapped to Pfam PF00600 |
| Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins) C-terminal part of Pfam PF00600 |
| Protein automated matches [190936] (7 species) not a true protein |
| Species Influenza A virus [TaxId:221021] [255355] (1 PDB entry) |
| Domain d2kkza1: 2kkz A:84-215 [242547] Other proteins in same PDB: d2kkza2 automated match to d3o9sa_ mutant |
PDB Entry: 2kkz (more details)
SCOPe Domain Sequences for d2kkza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kkza1 d.299.1.1 (A:84-215) automated matches {Influenza A virus [TaxId: 221021]}
mpasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrlet
lillrafteegaivgeisplpsfpghtiedvknaigvligglerndntvrvsktlqrfaw
gssnengrpplt
Timeline for d2kkza1: