SCOPe 2.04: Domain d2kkza_: 2kkz A:

Lineage for d2kkza_ (2kkz A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
   beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]

4. Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family)
   automatically mapped to Pfam PF00600

5. Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
   C-terminal part of Pfam PF00600

6. Protein automated matches [190936] (6 species)
   not a true protein

7. Species Influenza A virus [TaxId:221021] [255355] (1 PDB entry)

8. Domain d2kkza_: 2kkz A: [242547]
   automated match to d3o9sa_
   mutant

Details for d2kkza_

PDB Entry: 2kkz

PDB Description: solution nmr structure of the monomeric w187r mutant of a/udorn ns1 effector domain. northeast structural genomics target or8c[w187r].

PDB Compounds: (A:) Non-structural protein NS1

SCOPe Domain Sequences for d2kkza_:

Sequence; same for both SEQRES and ATOM records:

>d2kkza_ d.299.1.1 (A:) automated matches {Influenza A virus [TaxId: 221021]}
mpasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrlet
lillrafteegaivgeisplpsfpghtiedvknaigvligglerndntvrvsktlqrfaw
gssnengrppltle

Timeline for d2kkza_:

• d2kkza_ is new in SCOPe 2.04-stable
  
• d2kkza_ appears in SCOPe 2.05
  
• d2kkza_ appears in the current release, SCOPe 2.08, called d2kkza1