PDB entry 2kkz

View 2kkz on RCSB PDB site
Description: Solution NMR structure of the monomeric W187R mutant of A/Udorn NS1 effector domain. Northeast Structural Genomics target OR8C[W187R].
Class: antiviral protein
Keywords: Influenza A, Effector Domain, solution NMR structure, W187R mutant, Cytoplasm, Host-virus interaction, Interferon antiviral system evasion, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, ANTIVIRAL PROTEIN
Deposited on 2009-06-29, released 2009-07-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-07-21, with a file datestamp of 2009-07-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-structural protein NS1
    Species: Influenza A virus [TaxId:221021]
    Gene: NS, NS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6XSU2 (1-131)
      • initiating methionine (0)
      • engineered (103)
      • expression tag (132-133)
    Domains in SCOPe 2.04: d2kkza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2kkzA (A:)
    mpasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrlet
    lillrafteegaivgeisplpsfpghtiedvknaigvligglerndntvrvsktlqrfaw
    gssnengrppltlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kkzA (A:)
    mpasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrlet
    lillrafteegaivgeisplpsfpghtiedvknaigvligglerndntvrvsktlqrfaw
    gssnengrppltle