SCOPe 2.04: Domain d2kfma_: 2kfm A:

Lineage for d2kfma_ (2kfm A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [234629] (12 PDB entries)

8. Domain d2kfma_: 2kfm A: [242502]
   automated match to d1xyxa_
   mutant

Details for d2kfma_

PDB Entry: 2kfm

PDB Description: mouse prion protein (121-231) with mutations y225a and y226a

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2kfma_:

Sequence; same for both SEQRES and ATOM records:

>d2kfma_ d.6.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
svvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhdc
vnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqaaadgrrss

Timeline for d2kfma_:

• d2kfma_ is new in SCOPe 2.04-stable
  
• d2kfma_ appears in SCOPe 2.05
  
• d2kfma_ appears in the current release, SCOPe 2.08, called d2kfma1