Lineage for d2kejb_ (2kej B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732724Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1732725Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1732999Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 1733015Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 1733016Species Escherichia coli [TaxId:562] [47442] (14 PDB entries)
  8. 1733032Domain d2kejb_: 2kej B: [242484]
    automated match to d1l1ma_
    protein/DNA complex

Details for d2kejb_

PDB Entry: 2kej (more details)

PDB Description: solution structure of a dimer of lac repressor dna-binding domain complexed to its natural operator o2
PDB Compounds: (B:) lactose operon repressor

SCOPe Domain Sequences for d2kejb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kejb_ a.35.1.5 (B:) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
sl

SCOPe Domain Coordinates for d2kejb_:

Click to download the PDB-style file with coordinates for d2kejb_.
(The format of our PDB-style files is described here.)

Timeline for d2kejb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2keja_