SCOPe 2.05: Domain d2keja_: 2kej A:

Lineage for d2keja_ (2kej A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
   lacks the first helix of canonical fold
   3 helices; bundle, partly opened, right-handed twist

6. Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)

7. Species Escherichia coli [TaxId:562] [47442] (14 PDB entries)

8. Domain d2keja_: 2kej A: [242483]
   automated match to d1l1ma_
   protein/DNA complex

Details for d2keja_

PDB Entry: 2kej

PDB Description: solution structure of a dimer of lac repressor dna-binding domain complexed to its natural operator o2

PDB Compounds: (A:) lactose operon repressor

SCOPe Domain Sequences for d2keja_:

Sequence; same for both SEQRES and ATOM records:

>d2keja_ a.35.1.5 (A:) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
sl

Timeline for d2keja_:

• d2keja_ first appeared in SCOPe 2.04
  
• d2keja_ appears in SCOPe 2.06
  
• d2keja_ appears in the current release, SCOPe 2.08