PDB entry 2kej

View 2kej on RCSB PDB site
Description: Solution structure of a dimer of LAC repressor DNA-binding domain complexed to its natural operator O2
Class: Transcription/DNA
Keywords: Lac repressor, lac operators, NMR, protein-DNA complex, DNA-binding, Repressor, Transcription, Transcription regulation, Transcription/DNA COMPLEX
Deposited on 2009-01-30, released 2009-05-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactose operon repressor
    Species: Escherichia coli [TaxId:83333]
    Gene: lacI, b0345, JW0336
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023 (0-61)
      • engineered (51)
    Domains in SCOPe 2.05: d2keja_
  • Chain 'B':
    Compound: lactose operon repressor
    Species: Escherichia coli [TaxId:83333]
    Gene: lacI, b0345, JW0336
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023 (0-61)
      • engineered (51)
    Domains in SCOPe 2.05: d2kejb_
  • Chain 'C':
    Compound: DNA (5'-d(*gp*ap*ap*ap*tp*gp*tp*gp*ap*gp*cp*gp*ap*gp*tp*ap*ap*cp*ap*ap*cp*cp*g)-3')
  • Chain 'D':
    Compound: DNA (5'-d(p*cp*gp*gp*tp*tp*gp*tp*tp*ap*cp*tp*cp*gp*cp*tp*cp*ap*cp*ap*tp*tp*tp*c)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kejA (A:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
    sl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kejB (B:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
    sl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.