Lineage for d2kcga_ (2kcg A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030211Superfamily g.3.3: Cyclotides [57038] (4 families) (S)
    macrocyclic plant knottins closed with the formation of an Asn-Gly peptide
  5. 3030243Family g.3.3.3: Circulin A [57045] (2 proteins)
    automatically mapped to Pfam PF03784
  6. 3030247Protein automated matches [254523] (4 species)
    not a true protein
  7. 3030254Species Sweet violet (Viola odorata) [TaxId:97441] [255335] (3 PDB entries)
  8. 3030255Domain d2kcga_: 2kcg A: [242461]
    automated match to d1bh4a_

Details for d2kcga_

PDB Entry: 2kcg (more details)

PDB Description: solution structure of cycloviolacin o2
PDB Compounds: (A:) Cycloviolacin-O2

SCOPe Domain Sequences for d2kcga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kcga_ g.3.3.3 (A:) automated matches {Sweet violet (Viola odorata) [TaxId: 97441]}
gipcgescvwipcissaigcsckskvcyrn

SCOPe Domain Coordinates for d2kcga_:

Click to download the PDB-style file with coordinates for d2kcga_.
(The format of our PDB-style files is described here.)

Timeline for d2kcga_: