Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.3: Cyclotides [57038] (4 families) macrocyclic plant knottins closed with the formation of an Asn-Gly peptide |
Family g.3.3.3: Circulin A [57045] (2 proteins) automatically mapped to Pfam PF03784 |
Protein automated matches [254523] (4 species) not a true protein |
Species Sweet violet (Viola odorata) [TaxId:97441] [255335] (3 PDB entries) |
Domain d2kcga_: 2kcg A: [242461] automated match to d1bh4a_ |
PDB Entry: 2kcg (more details)
SCOPe Domain Sequences for d2kcga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kcga_ g.3.3.3 (A:) automated matches {Sweet violet (Viola odorata) [TaxId: 97441]} gipcgescvwipcissaigcsckskvcyrn
Timeline for d2kcga_: