![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.3: Cyclotides [57038] (4 families) ![]() macrocyclic plant knottins closed with the formation of an Asn-Gly peptide |
![]() | Family g.3.3.3: Circulin A [57045] (2 proteins) automatically mapped to Pfam PF03784 |
![]() | Protein Circulin A [57046] (1 species) cyclic 30-residue polypeptide |
![]() | Species Chassalia parviflora [TaxId:58431] [57047] (1 PDB entry) |
![]() | Domain d1bh4a_: 1bh4 A: [44079] by homology with the Kalata B1 linear precursor, the mature protein sequence probably begins at Gly28 and ends at Asn27 |
PDB Entry: 1bh4 (more details)
SCOPe Domain Sequences for d1bh4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bh4a_ g.3.3.3 (A:) Circulin A {Chassalia parviflora [TaxId: 58431]} cgescvwipcisaalgcscknkvcyrngip
Timeline for d1bh4a_: