Lineage for d1sacb_ (1sac B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1119051Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 1119119Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 1119120Species Human (Homo sapiens) [TaxId:9606] [49953] (10 PDB entries)
  8. 1119135Domain d1sacb_: 1sac B: [24238]
    complexed with acy, ca

Details for d1sacb_

PDB Entry: 1sac (more details), 2 Å

PDB Description: the structure of pentameric human serum amyloid p component
PDB Compounds: (B:) serum amyloid p component

SCOPe Domain Sequences for d1sacb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sacb_ b.29.1.5 (B:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOPe Domain Coordinates for d1sacb_:

Click to download the PDB-style file with coordinates for d1sacb_.
(The format of our PDB-style files is described here.)

Timeline for d1sacb_: