SCOPe 2.02: Domain d1sacc_: 1sac C:

Lineage for d1sacc_ (1sac C:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)

6. Protein Serum amyloid P component (SAP) [49952] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49953] (10 PDB entries)

8. Domain d1sacc_: 1sac C: [24239]
   complexed with acy, ca

Details for d1sacc_

PDB Entry: 1sac, 2 Å

PDB Description: the structure of pentameric human serum amyloid p component

PDB Compounds: (C:) serum amyloid p component

SCOPe Domain Sequences for d1sacc_:

Sequence; same for both SEQRES and ATOM records:

>d1sacc_ b.29.1.5 (C:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

Timeline for d1sacc_:

• d1sacc_ first appeared (with stable ids) in SCOP 1.55
  
• d1sacc_ appears in SCOPe 2.01
  
• d1sacc_ appears in SCOPe 2.03
  
• d1sacc_ appears in the current release, SCOPe 2.08