Lineage for d1sacb_ (1sac B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12752Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 12770Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 12771Species Human (Homo sapiens) [TaxId:9606] [49953] (2 PDB entries)
  8. 12773Domain d1sacb_: 1sac B: [24238]

Details for d1sacb_

PDB Entry: 1sac (more details), 2 Å

PDB Description: the structure of pentameric human serum amyloid p component

SCOP Domain Sequences for d1sacb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sacb_ b.29.1.5 (B:) Serum amyloid P component (SAP) {Human (Homo sapiens)}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOP Domain Coordinates for d1sacb_:

Click to download the PDB-style file with coordinates for d1sacb_.
(The format of our PDB-style files is described here.)

Timeline for d1sacb_: