Lineage for d1c4re_ (1c4r E:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12729Family b.29.1.4: Laminin G-like module [49944] (3 proteins)
  6. 12738Protein Ligand-binding domain of neurexin 1beta [49949] (1 species)
  7. 12739Species Rat (Rattus norvegicus) [TaxId:10116] [49950] (1 PDB entry)
  8. 12744Domain d1c4re_: 1c4r E: [24233]

Details for d1c4re_

PDB Entry: 1c4r (more details), 2.6 Å

PDB Description: the structure of the ligand-binding domain of neurexin 1beta: regulation of lns domain function by alternative splicing

SCOP Domain Sequences for d1c4re_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4re_ b.29.1.4 (E:) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus)}
hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvgev
p

SCOP Domain Coordinates for d1c4re_:

Click to download the PDB-style file with coordinates for d1c4re_.
(The format of our PDB-style files is described here.)

Timeline for d1c4re_: