SCOPe 2.06: Domain d2jvka1: 2jvk A:1-124

Lineage for d2jvka1 (2jvk A:1-124)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Sporulation response regulator Spo0F [52188] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [52189] (12 PDB entries)
   Uniprot P06628

8. Domain d2jvka1: 2jvk A:1-124 [242295]
   Other proteins in same PDB: d2jvka2
   automated match to d2fspa_
   mutant

Details for d2jvka1

PDB Entry: 2jvk

PDB Description: nmr solution structure of the hyper-sporulation response regulator spo0f mutant l66a from bacillus subtilis

PDB Compounds: (A:) sporulation initiation phosphotransferase f

SCOPe Domain Sequences for d2jvka1:

Sequence; same for both SEQRES and ATOM records:

>d2jvka1 c.23.1.1 (A:1-124) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
dgieiakrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
lksn

Timeline for d2jvka1:

• d2jvka1 first appeared in SCOPe 2.04, called d2jvka_
  
• d2jvka1 was called d2jvka_ in SCOPe 2.05
  
• d2jvka1 appears in SCOPe 2.07
  
• d2jvka1 appears in the current release, SCOPe 2.08