SCOPe 2.05: Domain d2jvka_: 2jvk A:

Lineage for d2jvka_ (2jvk A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Sporulation response regulator Spo0F [52188] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [52189] (12 PDB entries)
   Uniprot P06628

8. Domain d2jvka_: 2jvk A: [242295]
   automated match to d2fspa_
   mutant

Details for d2jvka_

PDB Entry: 2jvk

PDB Description: nmr solution structure of the hyper-sporulation response regulator spo0f mutant l66a from bacillus subtilis

PDB Compounds: (A:) sporulation initiation phosphotransferase f

SCOPe Domain Sequences for d2jvka_:

Sequence; same for both SEQRES and ATOM records:

>d2jvka_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
dgieiakrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
lksnlehhhhhh

Timeline for d2jvka_:

• d2jvka_ first appeared in SCOPe 2.04
  
• d2jvka_ is called d2jvka1 in SCOPe 2.06
  
• d2jvka_ appears in the current release, SCOPe 2.08, called d2jvka1