SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2jvka1 (2jvk A:1-124)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101602Family c.23.1.1: CheY-related [52173] (26 protein domains)
  6. 2101823Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 2101824Species Bacillus subtilis [TaxId:1423] [52189] (12 PDB entries)
    Uniprot P06628
  8. 2101841Domain d2jvka1: 2jvk A:1-124 [242295]
    Other proteins in same PDB: d2jvka2
    automated match to d2fspa_
    mutant

Details for d2jvka1

PDB Entry: 2jvk (more details)

PDB Description: NMR Solution Structure of the Hyper-Sporulation Response Regulator Spo0F Mutant L66A from Bacillus subtilis
PDB Compounds: (A:) sporulation initiation phosphotransferase f

SCOPe Domain Sequences for d2jvka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jvka1 c.23.1.1 (A:1-124) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
dgieiakrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
lksn

SCOPe Domain Coordinates for d2jvka1:

Click to download the PDB-style file with coordinates for d2jvka1.
(The format of our PDB-style files is described here.)

Timeline for d2jvka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jvka2