![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.12: TrpR-like [48295] (4 families) ![]() contains an extra shared helix after the HTH motif |
![]() | Family a.4.12.0: automated matches [254246] (1 protein) not a true family |
![]() | Protein automated matches [254563] (1 species) not a true protein |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [255292] (1 PDB entry) |
![]() | Domain d2jrta1: 2jrt A:1-92 [242274] Other proteins in same PDB: d2jrta2 automated match to d2oa4a1 |
PDB Entry: 2jrt (more details)
SCOPe Domain Sequences for d2jrta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jrta1 a.4.12.0 (A:1-92) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} mylkrvdgprqvtlpdgtvlsradlppldtrrwvasrkaavvkavihgliterealdrys lseeefalwrsavaahgekalkvtmiqkyrql
Timeline for d2jrta1: