SCOPe 2.08: Domain d2jrta1: 2jrt A:1-92

Lineage for d2jrta1 (2jrt A:1-92)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.12: TrpR-like [48295] (4 families)
   contains an extra shared helix after the HTH motif

5. Family a.4.12.0: automated matches [254246] (1 protein)
   not a true family

6. Protein automated matches [254563] (1 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [255292] (1 PDB entry)

8. Domain d2jrta1: 2jrt A:1-92 [242274]
   Other proteins in same PDB: d2jrta2
   automated match to d2oa4a1

Details for d2jrta1

PDB Entry: 2jrt

PDB Description: nmr solution structure of the protein coded by gene rhos4_12090 of rhodobacter sphaeroides. northeast structural genomics target rhr5

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2jrta1:

Sequence; same for both SEQRES and ATOM records:

>d2jrta1 a.4.12.0 (A:1-92) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mylkrvdgprqvtlpdgtvlsradlppldtrrwvasrkaavvkavihgliterealdrys
lseeefalwrsavaahgekalkvtmiqkyrql

Timeline for d2jrta1:

• d2jrta1 first appeared in SCOPe 2.04, called d2jrta_
  
• d2jrta1 appears in SCOPe 2.07