Lineage for d1gana_ (1gan A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins) 
Protein S-lectin, different isoforms [49933] (4 species) 
Species Toad (Bufo arenarum) [TaxId:38577] [49937] (2 PDB entries) 
Domain d1gana_: 1gan A: [24214]
Details for d1gana_
PDB Entry: 1gan (more details), 2.23 Å
PDB Description: complex of toad ovary galectin with n-acetylgalactose
SCOP Domain Sequences for d1gana_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gana_ b.29.1.3 (A:) S-lectin, different isoforms {Toad (Bufo arenarum)}
asagvavtnlnlkpghcveikgsippdckgfavnlgedasnfllhfnarfdlhgdvnkiv
cnskeadawgseqregvfpfqqgaevmvcfeyqtdkiiikfssgdqfsfpvrkvlpsipf
lsleglqfksitte
SCOP Domain Coordinates for d1gana_:
Click to download the PDB-style file with coordinates for d1gana_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gana_:
- d1gana_ appears in SCOP 1.57
- d1gana_ appears in the current release, SCOPe 2.08
View in 3D
