Lineage for d2gcfa_ (2gcf A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953868Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2954018Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 2954019Protein automated matches [191063] (9 species)
    not a true protein
  7. 2954048Species Synechocystis sp. [TaxId:1148] [255182] (3 PDB entries)
  8. 2954050Domain d2gcfa_: 2gcf A: [241919]
    automated match to d1kqka_

Details for d2gcfa_

PDB Entry: 2gcf (more details)

PDB Description: Solution structure of the N-terminal domain of the coppper(I) ATPase PacS in its apo form
PDB Compounds: (A:) cation-transporting ATPase pacs

SCOPe Domain Sequences for d2gcfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gcfa_ d.58.17.0 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}
maqtinlqlegmrcaacassieraiakvpgvqscqvnfaleqavvsyhgettpqiltdav
eragyharvlkqq

SCOPe Domain Coordinates for d2gcfa_:

Click to download the PDB-style file with coordinates for d2gcfa_.
(The format of our PDB-style files is described here.)

Timeline for d2gcfa_: