![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
![]() | Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
![]() | Protein Potential copper-translocating P-type ATPase CopA (YvgX) [75441] (1 species) duplication: contains tandem repeat of two HMA domains in the N-terminal region |
![]() | Species Bacillus subtilis [TaxId:1423] [75442] (6 PDB entries) |
![]() | Domain d1kqka_: 1kqk A: [72880] domain 2 complexed with cu1 |
PDB Entry: 1kqk (more details)
SCOPe Domain Sequences for d1kqka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqka_ d.58.17.1 (A:) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} mtekaefdiegmtcaacanriekrlnkiegvanapvnfaletvtveynpkeasvsdlkea vdklgyklklkgeqdsiegr
Timeline for d1kqka_: