PDB entry 2gcf

View 2gcf on RCSB PDB site
Description: Solution structure of the N-terminal domain of the coppper(I) ATPase PacS in its apo form
Class: hydrolase
Keywords: ferredoxin-like fold, beta-alpha-beta-beta-alpha-beta, Structural Genomics, Structural Proteomics in Europe, SPINE, HYDROLASE
Deposited on 2006-03-14, released 2006-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cation-transporting ATPase pacs
    Species: Synechocystis sp. [TaxId:1148]
    Gene: pacS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gcfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gcfA (A:)
maqtinlqlegmrcaacassieraiakvpgvqscqvnfaleqavvsyhgettpqiltdav
eragyharvlkqq