Lineage for d2fghb5 (2fgh B:533-628)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210161Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2210162Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2210377Family d.109.1.0: automated matches [191561] (1 protein)
    not a true family
  6. 2210378Protein automated matches [190971] (12 species)
    not a true protein
  7. 2210381Species Horse (Equus caballus) [TaxId:9796] [255171] (1 PDB entry)
  8. 2210392Domain d2fghb5: 2fgh B:533-628 [241848]
    automated match to d1d0na5
    complexed with atp

Details for d2fghb5

PDB Entry: 2fgh (more details), 2.8 Å

PDB Description: atp bound gelsolin
PDB Compounds: (B:) gelsolin

SCOPe Domain Sequences for d2fghb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fghb5 d.109.1.0 (B:533-628) automated matches {Horse (Equus caballus) [TaxId: 9796]}
pastrlfqvrasssgatraveiipkagalnsndafvlktpsaaylwvgagaseaektgaq
ellrvlraqpvqvaegsepdsfwealggkatyrtsp

SCOPe Domain Coordinates for d2fghb5:

Click to download the PDB-style file with coordinates for d2fghb5.
(The format of our PDB-style files is described here.)

Timeline for d2fghb5: