Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.0: automated matches [191561] (1 protein) not a true family |
Protein automated matches [190971] (14 species) not a true protein |
Species Horse (Equus caballus) [TaxId:9796] [255171] (1 PDB entry) |
Domain d2fghb5: 2fgh B:533-628 [241848] automated match to d1d0na5 complexed with atp |
PDB Entry: 2fgh (more details), 2.8 Å
SCOPe Domain Sequences for d2fghb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fghb5 d.109.1.0 (B:533-628) automated matches {Horse (Equus caballus) [TaxId: 9796]} pastrlfqvrasssgatraveiipkagalnsndafvlktpsaaylwvgagaseaektgaq ellrvlraqpvqvaegsepdsfwealggkatyrtsp
Timeline for d2fghb5: