Lineage for d1byh__ (1byh -)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226869Family b.29.1.2: beta-Glucanase-like [49925] (2 proteins)
  6. 226870Protein Bacillus 1-3,1-4-beta-glucanase [49926] (3 species)
  7. 226884Species Hybrid protein: residues 1-16 from Bacillus amyloliquefaciens and Bacillus macerans [49928] (3 PDB entries)
  8. 226887Domain d1byh__: 1byh - [24174]
    complexed with but, ca, glc

Details for d1byh__

PDB Entry: 1byh (more details), 2.8 Å

PDB Description: molecular and active-site structure of a bacillus (1-3,1-4)-beta- glucanase

SCOP Domain Sequences for d1byh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byh__ b.29.1.2 (-) Bacillus 1-3,1-4-beta-glucanase {Hybrid protein: residues 1-16 from Bacillus amyloliquefaciens and Bacillus macerans}
qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf
nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
mnlwngtgvddwlgsynganplyaeydwvkytsn

SCOP Domain Coordinates for d1byh__:

Click to download the PDB-style file with coordinates for d1byh__.
(The format of our PDB-style files is described here.)

Timeline for d1byh__: