![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) ![]() |
![]() | Family b.29.1.2: beta-Glucanase-like [49925] (2 proteins) |
![]() | Protein Bacillus 1-3,1-4-beta-glucanase [49926] (3 species) |
![]() | Species Hybrid protein: residues 1-16 from Bacillus amyloliquefaciens and Bacillus macerans [49928] (3 PDB entries) |
![]() | Domain d1byh__: 1byh - [24174] complexed with but, ca, glc |
PDB Entry: 1byh (more details), 2.8 Å
SCOP Domain Sequences for d1byh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byh__ b.29.1.2 (-) Bacillus 1-3,1-4-beta-glucanase {Hybrid protein: residues 1-16 from Bacillus amyloliquefaciens and Bacillus macerans} qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim mnlwngtgvddwlgsynganplyaeydwvkytsn
Timeline for d1byh__: