Lineage for d1byh__ (1byh -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.2: beta-Glucanase-like [49925] (2 proteins) 
Protein Bacillus 1-3,1-4-beta-glucanase [49926] (3 species) Species Hybrid protein: residues 1-16 from Bacillus amyloliquefaciens and Bacillus macerans [49928] (3 PDB entries) 
Domain d1byh__: 1byh - [24174]
Details for d1byh__
PDB Entry: 1byh (more details), 2.8 Å
PDB Description: molecular and active-site structure of a bacillus (1-3,1-4)-beta- glucanase
SCOP Domain Sequences for d1byh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byh__ b.29.1.2 (-) Bacillus 1-3,1-4-beta-glucanase {Hybrid protein: residues 1-16 from Bacillus amyloliquefaciens and Bacillus macerans}
qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf
nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
mnlwngtgvddwlgsynganplyaeydwvkytsn
SCOP Domain Coordinates for d1byh__:
Click to download the PDB-style file with coordinates for d1byh__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1byh__:
- d1byh__ appears in SCOP 1.57
- d1byh__ appears in the current release, SCOPe 2.08, called d1byha_
View in 3D