Lineage for d2doqa_ (2doq A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1490700Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 1490701Protein automated matches [190513] (24 species)
    not a true protein
  7. 1490704Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255121] (2 PDB entries)
  8. 1490709Domain d2doqa_: 2doq A: [241638]
    automated match to d2mysb_
    complexed with ca

Details for d2doqa_

PDB Entry: 2doq (more details), 3 Å

PDB Description: crystal structure of sfi1p/cdc31p complex
PDB Compounds: (A:) Cell division control protein 31

SCOPe Domain Sequences for d2doqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2doqa_ a.39.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
selleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkreildlideydsegrh
lmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrrvakelgetltdeel
ramieefdldgdgeinenefiaictd

SCOPe Domain Coordinates for d2doqa_:

Click to download the PDB-style file with coordinates for d2doqa_.
(The format of our PDB-style files is described here.)

Timeline for d2doqa_: