| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
| Protein automated matches [190513] (36 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255121] (3 PDB entries) |
| Domain d2doqa_: 2doq A: [241638] automated match to d2mysb_ complexed with ca |
PDB Entry: 2doq (more details), 3 Å
SCOPe Domain Sequences for d2doqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2doqa_ a.39.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
selleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkreildlideydsegrh
lmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrrvakelgetltdeel
ramieefdldgdgeinenefiaictd
Timeline for d2doqa_: