Lineage for d1g8wd_ (1g8w D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1532834Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1533351Protein Phytohemagglutinin-L, PHA-L, also arcelin [49920] (2 species)
    single-chain subunit has "generic" topology
  7. 1533352Species French bean (Phaseolus vulgaris) [TaxId:3885] [49921] (4 PDB entries)
  8. 1533359Domain d1g8wd_: 1g8w D: [24163]
    complexed with ca, mn, nag

Details for d1g8wd_

PDB Entry: 1g8w (more details), 2.8 Å

PDB Description: improved structure of phytohemagglutinin-l from the kidney bean
PDB Compounds: (D:) leucoagglutinating phytohemagglutinin

SCOPe Domain Sequences for d1g8wd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8wd_ b.29.1.1 (D:) Phytohemagglutinin-L, PHA-L, also arcelin {French bean (Phaseolus vulgaris) [TaxId: 3885]}
sndiyfnfqrfnetnlilqrdasvsssgqlrltnlngngeprvgslgrafysapiqiwdn
ttgtvasfatsftfniqvpnnagpadglafalvpvgsqpkdkggflglfdgsnsnfhtva
vefdtlynkdwdpterhigidvnsirsikttrwdfvngenaevlitydsstnllvaslvy
psqktsfivsdtvdlksvlpewvsvgfsattginkgnvetndvlswsfaskls

SCOPe Domain Coordinates for d1g8wd_:

Click to download the PDB-style file with coordinates for d1g8wd_.
(The format of our PDB-style files is described here.)

Timeline for d1g8wd_: