SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1g8wd_ (1g8w D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042723Protein Phytohemagglutinin-L, PHA-L, also arcelin [49920] (2 species)
    single-chain subunit has "generic" topology
  7. 2042724Species French bean (Phaseolus vulgaris) [TaxId:3885] [49921] (4 PDB entries)
  8. 2042731Domain d1g8wd_: 1g8w D: [24163]
    complexed with ca, mn, nag

Details for d1g8wd_

PDB Entry: 1g8w (more details), 2.8 Å

PDB Description: improved structure of phytohemagglutinin-l from the kidney bean
PDB Compounds: (D:) leucoagglutinating phytohemagglutinin

SCOPe Domain Sequences for d1g8wd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8wd_ b.29.1.1 (D:) Phytohemagglutinin-L, PHA-L, also arcelin {French bean (Phaseolus vulgaris) [TaxId: 3885]}
sndiyfnfqrfnetnlilqrdasvsssgqlrltnlngngeprvgslgrafysapiqiwdn
ttgtvasfatsftfniqvpnnagpadglafalvpvgsqpkdkggflglfdgsnsnfhtva
vefdtlynkdwdpterhigidvnsirsikttrwdfvngenaevlitydsstnllvaslvy
psqktsfivsdtvdlksvlpewvsvgfsattginkgnvetndvlswsfaskls

SCOPe Domain Coordinates for d1g8wd_:

Click to download the PDB-style file with coordinates for d1g8wd_.
(The format of our PDB-style files is described here.)

Timeline for d1g8wd_: