![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein Phytohemagglutinin-L, PHA-L, also arcelin [49920] (2 species) single-chain subunit has "generic" topology |
![]() | Species French bean (Phaseolus vulgaris) [TaxId:3885] [49921] (4 PDB entries) |
![]() | Domain d1g8wc_: 1g8w C: [24162] complexed with ca, mn, nag |
PDB Entry: 1g8w (more details), 2.8 Å
SCOPe Domain Sequences for d1g8wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8wc_ b.29.1.1 (C:) Phytohemagglutinin-L, PHA-L, also arcelin {French bean (Phaseolus vulgaris) [TaxId: 3885]} sndiyfnfqrfnetnlilqrdasvsssgqlrltnlngngeprvgslgrafysapiqiwdn ttgtvasfatsftfniqvpnnagpadglafalvpvgsqpkdkggflglfdgsnsnfhtva vefdtlynkdwdpterhigidvnsirsikttrwdfvngenaevlitydsstnllvaslvy psqktsfivsdtvdlksvlpewvsvgfsattginkgnvetndvlswsfaskls
Timeline for d1g8wc_: