SCOPe 2.07: Domain d2dnea1: 2dne A:8-102

Lineage for d2dnea1 (2dne A:8-102)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.0: automated matches [191593] (1 protein)
   not a true family

6. Protein automated matches [191080] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255119] (2 PDB entries)

8. Domain d2dnea1: 2dne A:8-102 [241623]
   Other proteins in same PDB: d2dnea2, d2dnea3
   automated match to d1y8ob_

Details for d2dnea1

PDB Entry: 2dne

PDB Description: solution structure of rsgi ruh-058, a lipoyl domain of human 2-oxoacid dehydrogenase

PDB Compounds: (A:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

SCOPe Domain Sequences for d2dnea1:

Sequence; same for both SEQRES and ATOM records:

>d2dnea1 b.84.1.0 (A:8-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkvplpslsptmqagtiarwekkegdkinegdliaevetdkatvgfesleecymakilva
egtrdvpigaiicitvgkpedieafknytldssaa

Timeline for d2dnea1:

• d2dnea1 first appeared in SCOPe 2.04, called d2dnea_
  
• d2dnea1 appears in SCOPe 2.06
  
• d2dnea1 appears in the current release, SCOPe 2.08