Lineage for d2dnea1 (2dne A:8-102)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2406232Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2406233Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2406314Family b.84.1.0: automated matches [191593] (1 protein)
    not a true family
  6. 2406315Protein automated matches [191080] (7 species)
    not a true protein
  7. 2406321Species Human (Homo sapiens) [TaxId:9606] [255119] (2 PDB entries)
  8. 2406322Domain d2dnea1: 2dne A:8-102 [241623]
    Other proteins in same PDB: d2dnea2, d2dnea3
    automated match to d1y8ob_

Details for d2dnea1

PDB Entry: 2dne (more details)

PDB Description: Solution Structure of RSGI RUH-058, a lipoyl domain of human 2-oxoacid dehydrogenase
PDB Compounds: (A:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

SCOPe Domain Sequences for d2dnea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dnea1 b.84.1.0 (A:8-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkvplpslsptmqagtiarwekkegdkinegdliaevetdkatvgfesleecymakilva
egtrdvpigaiicitvgkpedieafknytldssaa

SCOPe Domain Coordinates for d2dnea1:

Click to download the PDB-style file with coordinates for d2dnea1.
(The format of our PDB-style files is described here.)

Timeline for d2dnea1: