Lineage for d1y8ob_ (1y8o B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426782Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2426783Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 2426795Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
    component of the pyruvate dehydrogenase complex
  7. 2426804Species Human (Homo sapiens) [TaxId:9606] [51242] (8 PDB entries)
  8. 2426807Domain d1y8ob_: 1y8o B: [122759]
    Other proteins in same PDB: d1y8oa1, d1y8oa3
    automated match to d1fyca_
    complexed with adp, k, mg, red

Details for d1y8ob_

PDB Entry: 1y8o (more details), 2.48 Å

PDB Description: Crystal structure of the PDK3-L2 complex
PDB Compounds: (B:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

SCOPe Domain Sequences for d1y8ob_:

Sequence, based on SEQRES records: (download)

>d1y8ob_ b.84.1.1 (B:) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla
kilvpegtrdvplgtplciivekeadisafadyrptevtdlk

Sequence, based on observed residues (ATOM records): (download)

>d1y8ob_ b.84.1.1 (B:) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla
kilvpegtrdvplgtplciivekeadisafadytdlk

SCOPe Domain Coordinates for d1y8ob_:

Click to download the PDB-style file with coordinates for d1y8ob_.
(The format of our PDB-style files is described here.)

Timeline for d1y8ob_: