![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.1: Sialidases [50939] (3 families) ![]() |
![]() | Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) |
![]() | Protein automated matches [193245] (21 species) not a true protein |
![]() | Species Micromonospora viridifaciens [TaxId:1881] [254941] (4 PDB entries) |
![]() | Domain d2bzdc1: 2bzd C:48-402 [241392] Other proteins in same PDB: d2bzda2, d2bzda3, d2bzdb2, d2bzdb3, d2bzdc2, d2bzdc3 automated match to d1euta3 complexed with gal, gol, na |
PDB Entry: 2bzd (more details), 2 Å
SCOPe Domain Sequences for d2bzdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bzdc1 b.68.1.1 (C:48-402) automated matches {Micromonospora viridifaciens [TaxId: 1881]} eplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstdg grtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpadp nvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyti inaagafqavsvysddhgrtwrageavgvgmdanktvelsdgrvllnsrdsarsgyrkva vstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgti rmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlg
Timeline for d2bzdc1: