Lineage for d2bzdc1 (2bzd C:48-402)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2807608Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2807958Protein automated matches [193245] (21 species)
    not a true protein
  7. 2808067Species Micromonospora viridifaciens [TaxId:1881] [254941] (4 PDB entries)
  8. 2808074Domain d2bzdc1: 2bzd C:48-402 [241392]
    Other proteins in same PDB: d2bzda2, d2bzda3, d2bzdb2, d2bzdb3, d2bzdc2, d2bzdc3
    automated match to d1euta3
    complexed with gal, gol, na

Details for d2bzdc1

PDB Entry: 2bzd (more details), 2 Å

PDB Description: galactose recognition by the carbohydrate-binding module of a bacterial sialidase.
PDB Compounds: (C:) bacterial sialidase

SCOPe Domain Sequences for d2bzdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bzdc1 b.68.1.1 (C:48-402) automated matches {Micromonospora viridifaciens [TaxId: 1881]}
eplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstdg
grtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpadp
nvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyti
inaagafqavsvysddhgrtwrageavgvgmdanktvelsdgrvllnsrdsarsgyrkva
vstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgti
rmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlg

SCOPe Domain Coordinates for d2bzdc1:

Click to download the PDB-style file with coordinates for d2bzdc1.
(The format of our PDB-style files is described here.)

Timeline for d2bzdc1: