| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Micromonospora viridifaciens [TaxId:1881] [254943] (4 PDB entries) |
| Domain d2bzdb3: 2bzd B:506-647 [241391] Other proteins in same PDB: d2bzda1, d2bzda2, d2bzdb1, d2bzdb2, d2bzdc1, d2bzdc2 automated match to d1w8oa2 complexed with gal, gol, na |
PDB Entry: 2bzd (more details), 2 Å
SCOPe Domain Sequences for d2bzdb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bzdb3 b.18.1.0 (B:506-647) automated matches {Micromonospora viridifaciens [TaxId: 1881]}
qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis
glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv
alseqtghkyaavaelevegqr
Timeline for d2bzdb3: