Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein Legume lectin [49904] (23 species) |
Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries) |
Domain d1lu1a_: 1lu1 A: [24116] complexed with ade, ca, mn |
PDB Entry: 1lu1 (more details), 2.6 Å
SCOPe Domain Sequences for d1lu1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lu1a_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae pldlasylvrnvl
Timeline for d1lu1a_: