PDB entry 1lu1

View 1lu1 on RCSB PDB site
Description: the structure of the dolichos biflorus seed lectin in complex with the forssman disaccharide
Class: lectin
Keywords: legume lectins, forssman disaccharide, dolichos biflorus seed lectin
Deposited on 1998-07-24, released 1998-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.194
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Vigna unguiculata subsp. cylindrica [TaxId:3840]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05045 (0-252)
      • conflict (126)
    Domains in SCOPe 2.07: d1lu1a_
  • Heterogens: CA, MN, ADE

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lu1A (A:)
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
pldlasylvrnvl