Lineage for d1lu1__ (1lu1 -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12549Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)
  8. 12556Domain d1lu1__: 1lu1 - [24116]

Details for d1lu1__

PDB Entry: 1lu1 (more details), 2.6 Å

PDB Description: the structure of the dolichos biflorus seed lectin in complex with the forssman disaccharide

SCOP Domain Sequences for d1lu1__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lu1__ b.29.1.1 (-) Lectin {Horse gram (Dolichos biflorus), different isoforms}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
pldlasylvrnvl

SCOP Domain Coordinates for d1lu1__:

Click to download the PDB-style file with coordinates for d1lu1__.
(The format of our PDB-style files is described here.)

Timeline for d1lu1__: