| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (4 proteins) adopts thermolysin-like fold |
| Protein Tricorn protease interacting factor F3 catalytic domain [254381] (1 species) |
| Species Thermoplasma acidophilum [TaxId:2303] [254814] (2 PDB entries) |
| Domain d1z1wa2: 1z1w A:171-414 [241103] Other proteins in same PDB: d1z1wa1, d1z1wa3, d1z1wa4 complexed with so4, zn |
PDB Entry: 1z1w (more details), 2.7 Å
SCOPe Domain Sequences for d1z1wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z1wa2 d.92.1.13 (A:171-414) Tricorn protease interacting factor F3 catalytic domain {Thermoplasma acidophilum [TaxId: 2303]}
ryeyekyrdidlilaslkdirskypldmarksvefyenyfgipyalpkmhlisvpefgag
amenwgaitfreiymdiaensavtvkrnsanviaheiahqwfgdlvtmkwwndlwlnesf
atfmsyktmdtlfpewsfwgdffvsrtsgalrsdslknthpievdvrdpdeisqifdeis
ygkgasilrmiedyagyeefrkgiskylndhkfgnaegsdlwtaiedvsgkpvkrvmeyw
iknp
Timeline for d1z1wa2: