SCOPe 2.04: Domain d1z1wa2: 1z1w A:171-414

Lineage for d1z1wa2 (1z1w A:171-414)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (4 proteins)
   adopts thermolysin-like fold

6. Protein Tricorn protease interacting factor F3 catalytic domain [254381] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [254814] (2 PDB entries)

8. Domain d1z1wa2: 1z1w A:171-414 [241103]
   Other proteins in same PDB: d1z1wa1, d1z1wa3, d1z1wa4
   complexed with so4, zn

Details for d1z1wa2

PDB Entry: 1z1w, 2.7 Å

PDB Description: Crystal structures of the tricorn interacting facor F3 from Thermoplasma acidophilum, a zinc aminopeptidase in three different conformations

PDB Compounds: (A:) Tricorn protease interacting factor F3

SCOPe Domain Sequences for d1z1wa2:

Sequence; same for both SEQRES and ATOM records:

>d1z1wa2 d.92.1.13 (A:171-414) Tricorn protease interacting factor F3 catalytic domain {Thermoplasma acidophilum [TaxId: 2303]}
ryeyekyrdidlilaslkdirskypldmarksvefyenyfgipyalpkmhlisvpefgag
amenwgaitfreiymdiaensavtvkrnsanviaheiahqwfgdlvtmkwwndlwlnesf
atfmsyktmdtlfpewsfwgdffvsrtsgalrsdslknthpievdvrdpdeisqifdeis
ygkgasilrmiedyagyeefrkgiskylndhkfgnaegsdlwtaiedvsgkpvkrvmeyw
iknp

Timeline for d1z1wa2:

• d1z1wa2 is new in SCOPe 2.04-stable
  
• d1z1wa2 appears in SCOPe 2.05
  
• d1z1wa2 appears in the current release, SCOPe 2.08