Lineage for d1z1wa2 (1z1w A:171-414)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1918339Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
    adopts thermolysin-like fold
  6. 1918400Protein Tricorn protease interacting factor F3 catalytic domain [254381] (1 species)
  7. 1918401Species Thermoplasma acidophilum [TaxId:2303] [254814] (2 PDB entries)
  8. 1918404Domain d1z1wa2: 1z1w A:171-414 [241103]
    Other proteins in same PDB: d1z1wa1, d1z1wa3, d1z1wa4
    complexed with so4, zn

Details for d1z1wa2

PDB Entry: 1z1w (more details), 2.7 Å

PDB Description: Crystal structures of the tricorn interacting facor F3 from Thermoplasma acidophilum, a zinc aminopeptidase in three different conformations
PDB Compounds: (A:) Tricorn protease interacting factor F3

SCOPe Domain Sequences for d1z1wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1wa2 d.92.1.13 (A:171-414) Tricorn protease interacting factor F3 catalytic domain {Thermoplasma acidophilum [TaxId: 2303]}
ryeyekyrdidlilaslkdirskypldmarksvefyenyfgipyalpkmhlisvpefgag
amenwgaitfreiymdiaensavtvkrnsanviaheiahqwfgdlvtmkwwndlwlnesf
atfmsyktmdtlfpewsfwgdffvsrtsgalrsdslknthpievdvrdpdeisqifdeis
ygkgasilrmiedyagyeefrkgiskylndhkfgnaegsdlwtaiedvsgkpvkrvmeyw
iknp

SCOPe Domain Coordinates for d1z1wa2:

Click to download the PDB-style file with coordinates for d1z1wa2.
(The format of our PDB-style files is described here.)

Timeline for d1z1wa2: