Lineage for d1z1wa1 (1z1w A:1-170)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1562417Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 1562418Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 1562419Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)
  6. 1562479Protein Tricorn protease interacting factor F3 N-terminal domain [254379] (1 species)
  7. 1562480Species Thermoplasma acidophilum [TaxId:2303] [254812] (2 PDB entries)
  8. 1562483Domain d1z1wa1: 1z1w A:1-170 [241102]
    Other proteins in same PDB: d1z1wa2, d1z1wa3, d1z1wa4
    complexed with so4, zn

Details for d1z1wa1

PDB Entry: 1z1w (more details), 2.7 Å

PDB Description: Crystal structures of the tricorn interacting facor F3 from Thermoplasma acidophilum, a zinc aminopeptidase in three different conformations
PDB Compounds: (A:) Tricorn protease interacting factor F3

SCOPe Domain Sequences for d1z1wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1wa1 b.98.1.1 (A:1-170) Tricorn protease interacting factor F3 N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]}
mevekydltldfdiqkrtfngtetitadagdivldavglqinwmkvngrdtaftydgqtv
rapgdsqpqkieisfagkvsdslsgiyyagrengmitthfeatdarrmfpcvdhpaykav
faitvvidkdydaisnmppkrievserkvvefqdtprmstyllyvgigkf

SCOPe Domain Coordinates for d1z1wa1:

Click to download the PDB-style file with coordinates for d1z1wa1.
(The format of our PDB-style files is described here.)

Timeline for d1z1wa1: