Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (33 species) not a true protein |
Species Influenza virus [TaxId:375457] [256203] (2 PDB entries) |
Domain d4bh0d_: 4bh0 D: [240021] Other proteins in same PDB: d4bh0a_, d4bh0c_, d4bh0e_ automated match to d2fk0b1 complexed with nag, po4 |
PDB Entry: 4bh0 (more details), 2.36 Å
SCOPe Domain Sequences for d4bh0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bh0d_ h.3.1.1 (D:) automated matches {Influenza virus [TaxId: 375457]} ieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgre fnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdn akelgngcfefyhrcdnecmesvrngty
Timeline for d4bh0d_: