SCOPe 2.05: Domain d4bh0d_: 4bh0 D:

Lineage for d4bh0d_ (4bh0 D:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza virus [TaxId:375457] [256203] (2 PDB entries)

8. Domain d4bh0d_: 4bh0 D: [240021]
   Other proteins in same PDB: d4bh0a_, d4bh0c_, d4bh0e_
   automated match to d2fk0b1
   complexed with nag, po4

Details for d4bh0d_

PDB Entry: 4bh0, 2.36 Å

PDB Description: h5 (tyty) influenza virus haemagglutinin in complex with human receptor analogue 6'-sln

PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4bh0d_:

Sequence; same for both SEQRES and ATOM records:

>d4bh0d_ h.3.1.1 (D:) automated matches {Influenza virus [TaxId: 375457]}
ieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgre
fnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdn
akelgngcfefyhrcdnecmesvrngty

Timeline for d4bh0d_:

• d4bh0d_ first appeared in SCOPe 2.04
  
• d4bh0d_ appears in SCOPe 2.06
  
• d4bh0d_ appears in the current release, SCOPe 2.08