![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein Influenza hemagglutinin (stalk) [58066] (8 species) trimer |
![]() | Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries) |
![]() | Domain d2fk0b1: 2fk0 B:1-175 [133629] Other proteins in same PDB: d2fk0a1, d2fk0c_, d2fk0e_, d2fk0g_, d2fk0i_, d2fk0k_, d2fk0m_, d2fk0o_, d2fk0q_ |
PDB Entry: 2fk0 (more details), 2.95 Å
SCOPe Domain Sequences for d2fk0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fk0b1 h.3.1.1 (B:1-175) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss
Timeline for d2fk0b1: